A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10933 |
| Swiss-prot Accession number | P21252 (Sequence in FASTA format) |
| Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin](Fragment). |
| Source organism | Loxodonta africana (African elephant) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta. |
| Subcellular location | N/A |
| Developmental Stage | N/A |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
| Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
| Function | Beta-endorphin is an endogenous opiate |
| Protein Length | 134 Amino acids |
| Molecular weight | 14935 |
| References | 1 PubMed abstract 2854538 2 PubMed abstract 2854538 |
| Domain Name | ACTH_domain Op_neuropeptide |
| Hormone Name | Beta-endorphin |
| Mature Hormone Sequence | YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGH |
| Position of mature hormone in Pre-Hormone protein | 31 Residues from position (104-134) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |