A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10924 |
| Swiss-prot Accession number | P68001 (Sequence in FASTA format) |
| Description | Corticotropin-lipotropin (Pro-opiomelanocortin) (POMC) [Contains:Corticotropin (Adrenocorticotropic hormone) (ACTH); Melanotropin alpha(Alpha-MSH); Corticotropin-like intermediary peptide (CLIP)](Fragment). |
| Source organism | Balaenoptera physalus (Finback whale) (Common rorqual) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea;Mysticeti; Balaenopteridae; Balaenoptera. |
| Subcellular location | N/A |
| Developmental Stage | N/A |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
| Post translational modification | N/A |
| Function | ACTH stimulates the adrenal glands to release cortisol |
| Protein Length | 39 Amino acids |
| Molecular weight | 4541 |
| References | 1 Pankov Y.A., Nikolaeva O.P., Elisarova G.P.; "Primary structure of the corticotropin of whalebone whales, finbacks(Balaenoptera physalus)."; Bioorg. Khim. 2:855-856(1976).
2 Pankov Y.A., Nikolaeva O.P., Elisarova G.P.; "Primary structure of the corticotropin of whalebone whales, finbacks(Balaenoptera physalus)."; Bioorg. Khim. 2:855-856(1976). |
| Domain Name | ACTH_domain |
| Hormone Name | Corticotropin |
| Mature Hormone Sequence | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
| Position of mature hormone in Pre-Hormone protein | 39 Residues from position (1-39) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |