A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10917 |
Swiss-prot Accession number | P06298 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin A precursor (Pro-opiomelanocortin A) (POMC-A)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
Source organism | Xenopus laevis (African clawed frog) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the POMC family. |
Tissue Specificity | N/A |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | N/A |
Protein Length | 259 Amino acids |
Molecular weight | 29879 |
References | 1 PubMed abstract 3754961 2 PubMed abstract 1584015 3 Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases. 4 PubMed abstract 3840481 5 PubMed abstract 2564347 6 PubMed abstract 3754961 7 PubMed abstract 1584015 8 Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases. 9 PubMed abstract 3840481 10 PubMed abstract 2564347 |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Corticotropin |
Mature Hormone Sequence | AYSMEHFRWGKPVGRKRRPIKVYPNGVEEESAESYPMEL |
Position of mature hormone in Pre-Hormone protein | 39 Residues from position (140-178) |
Receptor | N/A |
Gene ID | 380532 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |