A database of hormones and their receptors

Peptide Hormone

HMRbase accession number	10889
Swiss-prot Accession number	P21563 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Rodentia sp.
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;unclassified rodents.
Subcellular location	Secreted. Note=Stored in spherulous cells prior to secretion
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	108 Amino acids
Molecular weight	11849
References	1 PubMed abstract 2531072 2 Bairoch A., Duret L.; Unpublished observations (FEB-1996). 3 Mueller W.E.G.; Unpublished observations (APR-1996).
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYILVCGERGFFYTPMS
Position of mature hormone in Pre-Hormone protein	31 Residues from position (24-54)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated