A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10879 |
Swiss-prot Accession number | P01315 (Sequence in FASTA format) |
Description | Insulin precursor [Contains: Insulin B chain; Insulin A chain]. |
Source organism | Sus scrofa (Pig) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
Protein Length | 108 Amino acids |
Molecular weight | 11672 |
References | 1 Han X.G., Tuch B.E.; "Complete porcine preproinsulin cDNA sequence."; Submitted (MAY-1998) to the EMBL/GenBank/DDBJ databases.
2 PubMed abstract 12140686 3 PubMed abstract 14574411 4 PubMed abstract 5657063 5 Chance R.E.; Submitted (JUL-1970) to the PIR data bank. 6 Blundell T.L., Dodson G.G., Hodgkin D., Mercola D.; "Insulin. The structure in the crystal and its reflection in chemistryand biology."; Adv. Protein Chem. 26:279-402(1972). 7 Isaacs N.W., Agarwal R.C.; "Experience with fast Fourier least squares in the refinement of thecrystal structure of rhombohedral 2-zinc insulin at 1.5-Aresolution."; Acta Crystallogr. A 34:782-791(1978). 8 PubMed abstract 2905485 9 PubMed abstract 1772633 10 PubMed abstract 2025410 11 PubMed abstract 15299880 |
Domain Name | Insulin |
Hormone Name | Insulin B chain |
Mature Hormone Sequence | FVNQHLCGSHLVEALYLVCGERGFFYTPKA |
Position of mature hormone in Pre-Hormone protein | 30 Residues from position (25-54) |
Receptor | N/A |
Gene ID | 397415 |
PDB ID | 1B17 1B18 1B19 1B2A 1B2B 1B2C 1B2D 1B2E 1B2F 1B2G 1DEI 1IZA 1IZB 1M5A 1MPJ 1SDB 1WAV 1ZEI 1ZNI 2EFA 2G4M 2TCI 3INS 3MTH 4INS 6INS 7INS 9INS |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |