A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10859 |
| Swiss-prot Accession number | P01330 (Sequence in FASTA format) |
| Description | Insulin [Contains: Insulin B chain; Insulin A chain]. |
| Source organism | Myocastor coypus (Coypu) (Nutria) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Myocastoridae; Myocastor. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
| Protein Length | 51 Amino acids |
| Molecular weight | 5897 |
| References | 1 Smith L.F.; "Amino acid sequences of insulins."; Diabetes 21 Suppl. 2:457-460(1972).
2 PubMed abstract 3541911 |
| Domain Name | Insulin |
| Hormone Name | Insulin B chain |
| Mature Hormone Sequence | YVSQRLCGSQLVDTLYSVCRHRGFYRPNDG |
| Position of mature hormone in Pre-Hormone protein | 29 Residues from position (1-29) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |