A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10780 |
Swiss-prot Accession number | P37240 (Sequence in FASTA format) |
Description | Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain). |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | Pituitary gland. Higher levels seen in immature fishes than the mature fishes |
Post translational modification | N/A |
Function | Indispensable for the control of thyroid structure and metabolism. May play some role in the biological processes of the immature fishes |
Protein Length | 147 Amino acids |
Molecular weight | 16440 |
References | 1 PubMed abstract 8327483 |
Domain Name | Cys_knot |
Hormone Name | Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain) |
Mature Hormone Sequence | MCVPTDYTLYEERRECDFCVAINTTICMGFCYSRDSNMKELAGPRFLIQRGCTYDQVEYRTVILPGCPLHANPLFTYPVALSCHCGTCNTDSDECAHKASSGDGARCSKPLRHIYPYPGLNSYIHPN |
Position of mature hormone in Pre-Hormone protein | 127 Residues from position (21-147) |
Receptor | N/A |
Gene ID | 100136289 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |