A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10764 |
Swiss-prot Accession number | P87391 (Sequence in FASTA format) |
Description | Somatotropin precursor (Growth hormone). |
Source organism | Sebastes schlegeli (Korean rockfish) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Scorpaeniformes;Scorpaenoidei; Sebastidae; Sebastinae; Sebastes. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation |
Protein Length | 204 Amino acids |
Molecular weight | 22977 |
References | 1 Lee J.H., Kim C.H., Cho J.M., Han G.B.; Submitted (FEB-1997) to the EMBL/GenBank/DDBJ databases.
|
Domain Name | Hormone_1 |
Hormone Name | Somatotropin |
Mature Hormone Sequence | QPITDGQRLFSIAVSRVQHLHQVAQRLFFEFESSLQTEEQRQLNKIFLQDYCNSDNIISPIDKHETQRSSILKLLSISYRLVESWEIPSRSLSGGSAPRNLISPKLTQLKAGILLLIEANQDGAELFPDSSALQLAPYGNYYQSLGADESLRRTYELLACFKKDMHKVETYLTVAKCRLSPEANCTL |
Position of mature hormone in Pre-Hormone protein | 187 Residues from position (18-204) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |