A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10762 |
Swiss-prot Accession number | P10813 (Sequence in FASTA format) |
Description | Somatotropin precursor (Growth hormone). |
Source organism | Rana catesbeiana (Bull frog) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana. |
Subcellular location | Secreted protein |
Developmental Stage | Levels increase as metamorphosis progresses, reach maxima in juveniles and decrease as adulthood approaches. |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Growth hormone plays an important role in growth control |
Protein Length | 215 Amino acids |
Molecular weight | 24975 |
References | 1 PubMed abstract 3260110 2 PubMed abstract 1476615 3 PubMed abstract 1859828 |
Domain Name | Hormone_1 |
Hormone Name | Somatotropin |
Mature Hormone Sequence | FPQMSLSNLFTNAVIRAQHLHQMVADTYRDYERTYIPEDQRFSNKHSYSVYCYSETIPAPTDKDNTHQKSDIDLLRFSLTLLQSWMTPIQIVNRVFGNNQVFGNIDRVYDRLRDLDEGLHILIRELDDGNVRNYGVLTFTYDKFDVNLRSEEGRAKNYGLLSCFKKDMHKVETYLKVMKCRRFVESNCTF |
Position of mature hormone in Pre-Hormone protein | 190 Residues from position (26-215) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |