A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10753 |
| Swiss-prot Accession number | P34746 (Sequence in FASTA format) |
| Description | Somatotropin precursor (Growth hormone). |
| Source organism | Oreochromis mossambicus (Mozambique tilapia) (Tilapia mossambica) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Labroidei;Cichlidae; African cichlids; Pseudocrenilabrinae; Tilapiini;Oreochromis. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Growth hormone plays an important role in growth control and involved in the regulation of several anabolic processes |
| Protein Length | 204 Amino acids |
| Molecular weight | 23151 |
| References | 1 Chen J.-Y., Chang C.-Y., Shen S.-C., Wang J.-I., Wu J.-L.; "Production of recombinant Oreochromis mossambicus growth hormone (GH)polypeptides in E. coli cells and characterization of the molecularstructure of the GH gene."; Submitted (NOV-1997) to the EMBL/GenBank/DDBJ databases.
2 PubMed abstract 2019405 |
| Domain Name | Hormone_1 |
| Hormone Name | Somatotropin |
| Mature Hormone Sequence | QQITDSQRLFSIAVNRVTHLYLLAQRLFSDFESSLQTEEQRQLNKIFLQDFCNSDYIISPIDKHETQRSSVLKLLSISYGLVESWEFPSRSLSGGSSLRNQISPRLSELKTGILLLIRANQDEAENYPDTDTLQHAPYGNYYQSLGGNESLRQTYELLACFKKDMHKVETYLTVAKCRLSPEANCTL |
| Position of mature hormone in Pre-Hormone protein | 187 Residues from position (18-204) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |