A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10737 |
Swiss-prot Accession number | P46404 (Sequence in FASTA format) |
Description | Somatotropin precursor (Growth hormone). |
Source organism | Felis silvestris catus (Cat) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues |
Protein Length | 216 Amino acids |
Molecular weight | 24454 |
References | 1 PubMed abstract 8654953 2 PubMed abstract 7642118 |
Domain Name | Hormone_1 |
Hormone Name | Somatotropin |
Mature Hormone Sequence | FPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIQALMRELEDGSPRGGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF |
Position of mature hormone in Pre-Hormone protein | 190 Residues from position (27-216) |
Receptor | N/A |
Gene ID | 493931 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |