A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10731 |
Swiss-prot Accession number | O13188 (Sequence in FASTA format) |
Description | Somatotropin precursor (Growth hormone). |
Source organism | Coregonus lavaretus (Common whitefish) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Coregonus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation |
Protein Length | 210 Amino acids |
Molecular weight | 23902 |
References | 1 PubMed abstract 9136024 |
Domain Name | Hormone_1 |
Hormone Name | Somatotropin |
Mature Hormone Sequence | MENQRLFNIAVNRVQHLHLMAQKMFNDFEGTLLPDERRQLNKIFLLDFCNSDSIVSPIDKHETQKSSVLKLLHISFRLIESWEYPSQTLTISNSLMVRNSNQISEKLGDLKVGINLLIKGSQDGVLSLDDNDFQQLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCRKSLEANCTL |
Position of mature hormone in Pre-Hormone protein | 188 Residues from position (23-210) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |