A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10720 |
| Swiss-prot Accession number | P08899 (Sequence in FASTA format) |
| Description | Somatotropin-1 precursor (Somatotropin I) (Growth hormone I). |
| Source organism | Anguilla japonica (Japanese eel) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Anguilliformes; Anguillidae;Anguilla. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation |
| Protein Length | 209 Amino acids |
| Molecular weight | 23556 |
| References | 1 PubMed abstract 2468582 2 PubMed abstract 3609715 |
| Domain Name | Hormone_1 |
| Hormone Name | Somatotropin-1 (Somatotropin I) (Growth hormone I) |
| Mature Hormone Sequence | VEPISLYNLFTSAVNRAQHLHTLAAEIYKEFERSIPPEAHRQLSKTSPLAGCYSDSIPTPTGKDETQEKSDGYLLRISSALIQSWVYPLKTLSDAFSNSLMFGTSDGIFDKLEDLNKGINELMKVVGDGGIYIEDVRNLRYENFDVHLRNDAGLMKNYGLLACFKKDMHKVETYLKVTKCRRFVESNCTL |
| Position of mature hormone in Pre-Hormone protein | 190 Residues from position (20-209) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |