A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10715 |
Swiss-prot Accession number | P26774 (Sequence in FASTA format) |
Description | Somatotropin-2 (Somatotropin II) (Growth hormone II). |
Source organism | Acipenser guldenstadti (Caspian sturgeon) (Russian sturgeon) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Chondrostei; Acipenseriformes; Acipenseridae;Acipenser. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation |
Protein Length | 190 Amino acids |
Molecular weight | 21821 |
References | 1 PubMed abstract 1576156 |
Domain Name | Hormone_1 |
Hormone Name | Somatotropin-2 (Somatotropin II) (Growth hormone II) |
Mature Hormone Sequence | YPMIPLSSLFTNAVLRAQYLHQLAADIYKDFERTYMPNEQRHSSKNSPSAFCYSETIPAPTGKDEAQQRSDVELLQFSLALIQSWISPLQSLSRVFTNSLVFLTSDRVFEKLKDLEEGIVALMRDLGEGGFGSSTLLKLTYDMFDVNLRNNDVLFKNYGLLSCFKKDMHKVETYLKVMKCRRFVESNCTL |
Position of mature hormone in Pre-Hormone protein | 190 Residues from position (1-190) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |