A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10714 |
Swiss-prot Accession number | P12855 (Sequence in FASTA format) |
Description | Somatotropin A precursor (Growth hormone A) (GH-A). |
Source organism | Xenopus laevis (African clawed frog) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Growth hormone plays an important role in growth control |
Protein Length | 214 Amino acids |
Molecular weight | 24700 |
References | 1 PubMed abstract 10618393 2 PubMed abstract 2734108 |
Domain Name | Hormone_1 |
Hormone Name | Somatotropin-A |
Mature Hormone Sequence | FPSVPLFSLFTNAVSRAQYIHMLAADTYRDYERTYITDEQRHSNKNSHVVSCYSETIPYPTDKDNTHQKSDLELLRFSLNLIQSWLNPVQALNKVFSNNLVFGSSDVYERLKYLEEGIQALMQELEDGSFRSFPFLRPPYERFDINLRSDDALVKVYGLLSCFKKDMHKVETYLKVMKCRRFVESNCTI |
Position of mature hormone in Pre-Hormone protein | 189 Residues from position (26-214) |
Receptor | N/A |
Gene ID | 399154 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |