A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10710 |
Swiss-prot Accession number | P58757 (Sequence in FASTA format) |
Description | Growth hormone variant precursor (GH-V) (Placenta-specific growthhormone) (Growth hormone 2). |
Source organism | Pan troglodytes (Chimpanzee) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Pan. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | Expressed in the placenta |
Post translational modification | N/A |
Function | Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues |
Protein Length | 217 Amino acids |
Molecular weight | 24991 |
References | 1 Revol A., Esquivel D., Santiago D., Barrera-Saldana H.; "Independent duplication of the growth hormone gene in threeAnthropoidean lineages."; Submitted (APR-2001) to the EMBL/GenBank/DDBJ databases.
|
Domain Name | Hormone_1 |
Hormone Name | Growth hormone variant |
Mature Hormone Sequence | FPTIPLSRLFDNAMLRAHRLYQLAYDTYQEFEEAYILKEQKYSFLQNPQTSLCFSESIPTPSNRVKTQQKSNLELLRISLLLIQSWLEPVQLLRSVFANSLVYGASDSNVYRHLKDLEEGIQTLMWRLEDGSPRTGQIFNQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF |
Position of mature hormone in Pre-Hormone protein | 191 Residues from position (27-217) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |