A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10707 |
Swiss-prot Accession number | P42692 (Sequence in FASTA format) |
Description | Somatoliberin (Growth hormone-releasing factor) (GRF) (Growth hormone-releasing hormone) (GHRH). |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone |
Protein Length | 45 Amino acids |
Molecular weight | 4979 |
References | 1 PubMed abstract 1475012 |
Domain Name | Hormone_2 |
Hormone Name | Somatoliberin |
Mature Hormone Sequence | HADGMFNKAYRKALGQLSARKYLHTLMAKRVGGGSMIEDDNEPLS |
Position of mature hormone in Pre-Hormone protein | 45 Residues from position (1-45) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |