A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10705 |
Swiss-prot Accession number | Q9GL67 (Sequence in FASTA format) |
Description | Parathyroid hormone precursor (Parathyrin) (PTH). |
Source organism | Felis silvestris catus (Cat) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis. |
Subcellular location | Secreted protein (By similarity) |
Developmental Stage | N/A |
Similarity | Belongs to the parathyroid hormone family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion |
Protein Length | 115 Amino acids |
Molecular weight | 12921 |
References | 1 Toribio R.E., Kohn C.W., Leone G.W., Capen C.C., Rosol T.J.; "Molecular cloning of feline preproparathyroid hormone."; Submitted (OCT-2000) to the EMBL/GenBank/DDBJ databases.
|
Domain Name | Parathyroid |
Hormone Name | Parathyroid hormone (Parathyrin) (PTH) |
Mature Hormone Sequence | SVSEIQFMHNLGKHLSSVERVEWLRRKLQDVHNFVALGAPIAHRDGGSQRPRKKEDNVPAENHQKSLGEADKADVDVLIKAKSQ |
Position of mature hormone in Pre-Hormone protein | 84 Residues from position (32-115) |
Receptor | N/A |
Gene ID | 493684 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |