A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10703 |
Swiss-prot Accession number | P33580 (Sequence in FASTA format) |
Description | Placental prolactin-like protein H precursor (PRL-like protein H)(PLP-H) (Growth hormone-related placental protein 3). |
Source organism | Rattus norvegicus (Rat) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
Subcellular location | Secreted protein |
Developmental Stage | Mid to late gestation (gestation day 15). |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | Placental basal zone cells |
Post translational modification | N/A |
Function | N/A |
Protein Length | 239 Amino acids |
Molecular weight | 27407 |
References | 1 PubMed abstract 9832436 2 PubMed abstract 2351117 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin-8A4 |
Mature Hormone Sequence | IPACMVEEGDCWDPLQETFNSAIQRAETLCNLADQLYVEFYQNQFSSRQFADLNSKLIKRDETVLKAGIYCHSTLAKPQTRGGNFEIEEHLKMLINFVGSWISPLFHLVIELSAMEGVPETILCKVKDLEENNRQLLDDLRWILTKVSPTAEIREEFPSWEHLSFLKSSNKNNKFLAMFNLSNCLDNDTKFTLHHLRIFKCLITGKDC |
Position of mature hormone in Pre-Hormone protein | 208 Residues from position (32-239) |
Receptor | N/A |
Gene ID | 59088 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |