![]() |
|
|
|
|
|
|
HMRbase accession number | 10670 |
Swiss-prot Accession number | P01299 (Sequence in FASTA format) |
Description | Pancreatic prohormone precursor (Pancreatic polypeptide) (PP)[Contains: Pancreatic hormone; Pancreatic icosapeptide]. |
Source organism | Canis familiaris (Dog) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;Canis. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the NPY family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions |
Protein Length | 93 Amino acids |
Molecular weight | 10427 |
References | 1 PubMed abstract 3079195 2 Chance R.E., Moon N.E., Johnson M.G.; (In) Jaffe B.M., Behrman H.R. (eds.);Methods of hormone radioimmunoassay (2nd ed.), pp.657-672, AcademicPress, New York and London (1979). 3 PubMed abstract 7031480 4 PubMed abstract 3827854 |
Domain Name | Hormone_3 |
Hormone Name | Pancreatic hormone |
Mature Hormone Sequence | APLEPVYPGDDATPEQMAQYAAELRRYINMLTRPRY |
Position of mature hormone in Pre-Hormone protein | 36 Residues from position (30-65) |
Receptor | N/A |
Gene ID | 490944 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |