A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10670 |
| Swiss-prot Accession number | P01299 (Sequence in FASTA format) |
| Description | Pancreatic prohormone precursor (Pancreatic polypeptide) (PP)[Contains: Pancreatic hormone; Pancreatic icosapeptide]. |
| Source organism | Canis familiaris (Dog) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;Canis. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the NPY family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions |
| Protein Length | 93 Amino acids |
| Molecular weight | 10427 |
| References | 1 PubMed abstract 3079195 2 Chance R.E., Moon N.E., Johnson M.G.; (In) Jaffe B.M., Behrman H.R. (eds.);Methods of hormone radioimmunoassay (2nd ed.), pp.657-672, AcademicPress, New York and London (1979). 3 PubMed abstract 7031480 4 PubMed abstract 3827854 |
| Domain Name | Hormone_3 |
| Hormone Name | Pancreatic hormone |
| Mature Hormone Sequence | APLEPVYPGDDATPEQMAQYAAELRRYINMLTRPRY |
| Position of mature hormone in Pre-Hormone protein | 36 Residues from position (30-65) |
| Receptor | N/A |
| Gene ID | 490944 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |