A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10667 |
Swiss-prot Accession number | P06305 (Sequence in FASTA format) |
Description | Pancreatic hormone (Pancreatic polypeptide) (PP). |
Source organism | Alligator mississippiensis (American alligator) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Crocodylidae; Alligatorinae; Alligator. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the NPY family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions |
Protein Length | 36 Amino acids |
Molecular weight | 4195 |
References | 1 PubMed abstract 6745282 2 PubMed abstract 6146554 |
Domain Name | Hormone_3 |
Hormone Name | Pancreatic hormone |
Mature Hormone Sequence | TPLQPKYPGDGAPVEDLIQFYDDLQQYLNVVTRPRF |
Position of mature hormone in Pre-Hormone protein | 36 Residues from position (1-36) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |