A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10664 |
Swiss-prot Accession number | Q09169 (Sequence in FASTA format) |
Description | Glucagon family neuropeptides precursor [Contains: Growth hormone-releasing factor (GRF) (Growth hormone-releasing hormone) (GHRH);Pituitary adenylate cyclase-activating polypeptide 27 (PACAP-27)(PACAP27); Pituitary adenylate cyclase-activating polypeptide 38(PACAP-38) (PACAP38)]. |
Source organism | Rana ridibunda (Laughing frog) (Marsh frog) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Pelophylax. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Primary role of GRF is to release GH from the pituitary |
Protein Length | 171 Amino acids |
Molecular weight | 19680 |
References | 1 PubMed abstract 10813784 2 PubMed abstract 1720095 |
Domain Name | Hormone_2 |
Hormone Name | Growth hormone-releasing factor (GRF) (Growth hormone-releasing hormone) (GHRH) |
Mature Hormone Sequence | HADDLLNKAYRNLLGQLSARKYLHTLMAKHLGAVSSSLEDDSEPLS |
Position of mature hormone in Pre-Hormone protein | 46 Residues from position (79-124) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |