A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10644 |
Swiss-prot Accession number | P80071 (Sequence in FASTA format) |
Description | Lutropin subunit beta (Luteinizing hormone subunit beta) (LSH-beta)(LSH-B) (LH-B) (Lutropin beta chain). |
Source organism | Rana catesbeiana (Bull frog) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 112 Amino acids |
Molecular weight | 12676 |
References | 1 PubMed abstract 1555571 |
Domain Name | Cys_knot |
Hormone Name | Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta) |
Mature Hormone Sequence | RHVCHLANATISAEKDHCPVCITFTTSICTGYCQTMDPVYKTALSSFKQNICTYKEIRYDTIKLPDCLPGTDPFFTYPVALSCYCDLCKMDYSDCTVESSEPDVCMKRRISI |
Position of mature hormone in Pre-Hormone protein | 112 Residues from position (1-112) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |