A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10641 |
Swiss-prot Accession number | P45646 (Sequence in FASTA format) |
Description | Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain). |
Source organism | Meleagris gallopavo (Common turkey) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Meleagris. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids |
Protein Length | 159 Amino acids |
Molecular weight | 16285 |
References | 1 PubMed abstract 7772235 |
Domain Name | Cys_knot |
Hormone Name | Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta) |
Mature Hormone Sequence | LGGGGRPPCRPINVTVAVEKDECPQCMAVTTTACGGYCRTREPVYRSPLGRPPQSSCTYGALRYERWALWGCPIGSDPRVLLPVALSCRCARCPIATSDCTVQGLGPAFCGAPGGFGIGE |
Position of mature hormone in Pre-Hormone protein | 120 Residues from position (40-159) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |