A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10632 |
Swiss-prot Accession number | P37038 (Sequence in FASTA format) |
Description | Gonadotropin subunit beta-2 precursor (Gonadotropin beta-II chain)(GTH-II-beta) (Luteinizing hormone-like GTH). |
Source organism | Hypophthalmichthys molitrix (Silver carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Hypophthalmichthys. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Involved in gametogenesis and steroidogenesis |
Protein Length | 141 Amino acids |
Molecular weight | 15856 |
References | 1 PubMed abstract 2332148 |
Domain Name | Cys_knot |
Hormone Name | Gonadotropin subunit beta-2 |
Mature Hormone Sequence | SFLPPCEPVNETVAVEKEGCPKCLVFQTTICSGHCLTKEPVYKSPFSTVYQHVCTYRDVRYETVRLPDCPPGVDPHITYPVALSCDCSLCTMDTSDCTIESLQPDYCMSQREDFP |
Position of mature hormone in Pre-Hormone protein | 115 Residues from position (25-139) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |