A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10631 |
Swiss-prot Accession number | P01235 (Sequence in FASTA format) |
Description | Gonadotropin subunit beta-2 precursor (Gonadotropin beta-II chain)(GTH-II-beta) (Luteinizing hormone-like GTH). |
Source organism | Cyprinus carpio (Common carp) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Involved in gametogenesis and steroidogenesis |
Protein Length | 144 Amino acids |
Molecular weight | 16040 |
References | 1 PubMed abstract 3246480 2 Chang Y.S., Huang F.-L., Lo T.-B.; Submitted (MAY-1991) to the EMBL/GenBank/DDBJ databases. 3 PubMed abstract 607993 |
Domain Name | Cys_knot |
Hormone Name | Gonadotropin beta-II chain (GTH-II-beta) |
Mature Hormone Sequence | SYLPPCEPVNETVAVEKEGCPKCLVLQTTICSGHCLTKEPVYKSPFSTVYQHVCTYRDVRYETVRLPDCPPGVDPHITYPVALSCDCSLCTMDTSDCTIESLQPDFCMSQREDFL |
Position of mature hormone in Pre-Hormone protein | 115 Residues from position (28-142) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |