A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10622 |
Swiss-prot Accession number | P53542 (Sequence in FASTA format) |
Description | Glycoprotein hormones alpha chain precursor (Gonadotropin alpha chain)(GTH-alpha). |
Source organism | Clarias gariepinus (Sharptooth catfish) (African catfish) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes;Clariidae; Clarias. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Involved in gametogenesis and steroidogenesis |
Protein Length | 116 Amino acids |
Molecular weight | 13060 |
References | 1 Rebers F.E.M., Tensen C.P., Schulz R.W., Goos H.J.T., Bogerd J.; Submitted (MAY-1996) to the EMBL/GenBank/DDBJ databases.
|
Domain Name | Hormone_6 |
Hormone Name | Glycoprotein hormones alpha chain |
Mature Hormone Sequence | YPNNDFGCEECKLKENNIFSKPGAPVYQCMGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAKEVKRVIVNDVKLVNHTDCHCSTCYYHKF |
Position of mature hormone in Pre-Hormone protein | 92 Residues from position (25-116) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |