A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10619 |
Swiss-prot Accession number | P30970 (Sequence in FASTA format) |
Description | Glycoprotein hormones alpha chain precursor (Gonadotropin alpha chain)(GTH-alpha). |
Source organism | Acanthopagrus latus (Yellowfin porgy) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Percoidei;Sparidae; Acanthopagrus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Involved in gametogenesis and steroidogenesis |
Protein Length | 117 Amino acids |
Molecular weight | 13061 |
References | 1 Tsai H.J., Chen Y.L.; "Molecular cloning and sequencing of yellowfin porgy gonadotropinalpha-subunit cDNA."; Submitted (JUN-1992) to the EMBL/GenBank/DDBJ databases.
|
Domain Name | Hormone_6 |
Hormone Name | Glycoprotein hormones alpha chain |
Mature Hormone Sequence | YPNTDLSNMGCEACTLRKNTVFSRDRPIYQCMGCCFSRAYPTPLKAMKTMTIPKNITSEATCCVAKHVYETEVAGIRVRNHTDCHCSTCYYHKI |
Position of mature hormone in Pre-Hormone protein | 94 Residues from position (24-117) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |