A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10617 |
Swiss-prot Accession number | P69063 (Sequence in FASTA format) |
Description | Glycoprotein hormones alpha chain 2 precursor (Gonadotropin 2 alphachain) (GTH-alpha). |
Source organism | Oncorhynchus keta (Chum salmon) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Involved in gametogenesis and steroidogenesis |
Protein Length | 114 Amino acids |
Molecular weight | 12538 |
References | 1 PubMed abstract 2466605 2 PubMed abstract 2813416 |
Domain Name | Hormone_6 |
Hormone Name | Glycoprotein hormones alpha chain 2 |
Mature Hormone Sequence | YPNSDKTNMGCEECTLKPNTIFPNIMQCTGCCFSRAYPTPLRSKQTMLVPKNITSEATCCVAKEGERVTTKDGFPVTNHTECHCSTCYYHKS |
Position of mature hormone in Pre-Hormone protein | 92 Residues from position (23-114) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |