A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10606 |
Swiss-prot Accession number | P01362 (Sequence in FASTA format) |
Description | ELH precursor [Contains: Alpha-bag cell peptide (Alpha-BCP); Beta-bagcell peptide (Beta-BCP); Gamma-bag cell peptide (Gamma-BCP); Egg-laying hormone (ELH); Acidic peptide]. |
Source organism | Aplysia californica (California sea hare) |
Taxonomical Classification | Eukaryota; Metazoa; Mollusca; Gastropoda; Orthogastropoda;Apogastropoda; Heterobranchia; Euthyneura; Opisthobranchia; Anaspidea;Aplysioidea; Aplysiidae; Aplysia. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the molluscan ELH family. |
Tissue Specificity | Bag cell neurons |
Post translational modification | N/A |
Function | N/A |
Protein Length | 271 Amino acids |
Molecular weight | 30827 |
References | 1 PubMed abstract 6687446 2 PubMed abstract 16593372 3 PubMed abstract 293751 4 PubMed abstract 3549995 |
Domain Name | ELH |
Hormone Name | Delta-bag cell peptide |
Mature Hormone Sequence | DQDEGNFRRFPTNAVSMSADENSPFDLSNEDGAVYQRDL |
Position of mature hormone in Pre-Hormone protein | 39 Residues from position (110-148) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |