A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10605 |
| Swiss-prot Accession number | P01362 (Sequence in FASTA format) |
| Description | ELH precursor [Contains: Alpha-bag cell peptide (Alpha-BCP); Beta-bagcell peptide (Beta-BCP); Gamma-bag cell peptide (Gamma-BCP); Egg-laying hormone (ELH); Acidic peptide]. |
| Source organism | Aplysia californica (California sea hare) |
| Taxonomical Classification | Eukaryota; Metazoa; Mollusca; Gastropoda; Orthogastropoda;Apogastropoda; Heterobranchia; Euthyneura; Opisthobranchia; Anaspidea;Aplysioidea; Aplysiidae; Aplysia. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the molluscan ELH family. |
| Tissue Specificity | Bag cell neurons |
| Post translational modification | N/A |
| Function | N/A |
| Protein Length | 271 Amino acids |
| Molecular weight | 30827 |
| References | 1 PubMed abstract 6687446 2 PubMed abstract 16593372 3 PubMed abstract 293751 4 PubMed abstract 3549995 |
| Domain Name | ELH |
| Hormone Name | Gamma-delta-bag cell peptide |
| Mature Hormone Sequence | RLRFDRRDQDEGNFRRFPTNAVSMSADENSPFDLSNEDGAVYQRDL |
| Position of mature hormone in Pre-Hormone protein | 46 Residues from position (103-148) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |