HMRbase accession number | 10603 |
Swiss-prot Accession number | Q07892 (Sequence in FASTA format) |
Description | Eclosion hormone precursor (Ecdysis activator) (EH). |
Source organism | Drosophila melanogaster (Fruit fly) |
Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha;Ephydroidea; Drosophilidae; Drosophila. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the insect eclosion hormone family. |
Tissue Specificity | Expressed in a single pair of brain neurons which extend their processes the entire length of the central nervous system and also to the corpora cardiaca portion of the ring gland. These cells show massive depletion of immunoreactive Eh at ecdysis |
Post translational modification | N/A |
Function | Neuropeptide that triggers the performance of ecdysis behaviors at the end of a molt. It triggers adult behavior patterns: larval, pupal and adult ecdysis, and plasticization during the molt |
Protein Length | 97 Amino acids |
Molecular weight | 10610 |
References | 1 PubMed abstract 8344291 2 PubMed abstract 10731132 3 PubMed abstract 12537572 4 Stapleton M., Carlson J.W., Chavez C., Frise E., George R.A.,Pacleb J.M., Park S., Wan K.H., Yu C., Celniker S.E.; Submitted (MAY-2005) to the EMBL/GenBank/DDBJ databases.
|
Domain Name | Eclosion |
Hormone Name | Eclosion hormone |
Mature Hormone Sequence | LVHFGNALPAISHYTHKRFDSMGGIDFVQVCLNNCVQCKTMLGDYFQGQTCALSCLKFKGKAIPDCEDIASIAPFLNALE |
Position of mature hormone in Pre-Hormone protein | 80 Residues from position (18-97) |
Receptor | N/A |
Gene ID | 42101 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |