A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10602 |
Swiss-prot Accession number | P25331 (Sequence in FASTA format) |
Description | Eclosion hormone precursor (Ecdysis activator) (EH). |
Source organism | Bombyx mori (Silk moth) |
Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the insect eclosion hormone family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Neuropeptide that triggers the performance of ecdysis behaviors at the end of a molt. It triggers adult behavior patterns: larval, pupal and adult ecdysis, and plasticization during the molt |
Protein Length | 88 Amino acids |
Molecular weight | 9505 |
References | 1 PubMed abstract 1370883 2 Kono T., Nagasawa H., Isogai A., Fugo H., Suzuki A.; "Amino acid sequence of eclosion hormone of the silkworm, Bombyxmori."; Agric. Biol. Chem. 51:2307-2308(1987). |
Domain Name | Eclosion |
Hormone Name | Eclosion hormone |
Mature Hormone Sequence | SPAIASSYDAMEICIENCAQCKKMFGPWFEGSLCAESCIKARGKDIPECESFASISPFLNKL |
Position of mature hormone in Pre-Hormone protein | 62 Residues from position (27-88) |
Receptor | N/A |
Gene ID | 692740 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |