A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10601 |
Swiss-prot Accession number | P67801 (Sequence in FASTA format) |
Description | Diuretic hormone (DH) (Diuretic peptide) (DP). |
Source organism | Stomoxys calcitrans (Stable fly) |
Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea;Muscidae; Stomoxys. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Regulation of fluid secretion. Stimulates primary urine secretion by Malpighian tubules and causes a dose-dependent stimulation of cAMP levels in the tubules. May act as clearance peptide in that it may remove metabolic waste from the hemolymph |
Protein Length | 44 Amino acids |
Molecular weight | 5181 |
References | 1 PubMed abstract 7991460 |
Domain Name | CRF |
Hormone Name | Diuretic hormone |
Mature Hormone Sequence | NKPSLSIVNPLDVLRQRLLLEIARRQMKENTRQVELNRAILKNV |
Position of mature hormone in Pre-Hormone protein | 44 Residues from position (1-44) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |