A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10595 |
Swiss-prot Accession number | P01243 (Sequence in FASTA format) |
Description | Chorionic somatomammotropin hormone precursor (Choriomammotropin)(Lactogen). |
Source organism | Homo sapiens (Human) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Hominidae; Homo. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Similar to that of somatotropin |
Protein Length | 217 Amino acids |
Molecular weight | 25020 |
References | 1 PubMed abstract 6208192 2 PubMed abstract 3030680 3 PubMed abstract 6300056 4 PubMed abstract 2744760 5 PubMed abstract 7169009 6 Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,Phelan M., Farmer A.; "Cloning of human full-length CDSs in BD Creator(TM) system donorvector."; Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases. 7 PubMed abstract 15489334 8 PubMed abstract 593368 9 PubMed abstract 4712450 10 PubMed abstract 5286363 11 Sherwood L.M., Handwerger S., McLaurin W.D., Lanner M.; Nature New Biol. 235:64-64(1972). 12 PubMed abstract 438159 |
Domain Name | Hormone_1 |
Hormone Name | Chorionic somatomammotropin hormone (Choriomammotropin) (Lactogen) |
Mature Hormone Sequence | VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF |
Position of mature hormone in Pre-Hormone protein | 191 Residues from position (27-217) |
Receptor | N/A |
Gene ID | 1442 |
PDB ID | 1Z7C |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |