A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10590 |
Swiss-prot Accession number | P49926 (Sequence in FASTA format) |
Description | Corticoliberin precursor (Corticotropin-releasing factor) (CRF)(Corticotropin-releasing hormone). |
Source organism | Canis familiaris (Dog) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;Canis. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | This hormone from hypothalamus regulates the release of corticotropin from pituitary gland |
Protein Length | 196 Amino acids |
Molecular weight | 21547 |
References | 1 Kansaku N., Yamagishi K., Mizushima S.; "PCR cloning of dog corticotropin releasing hormone gene."; Submitted (FEB-2004) to the EMBL/GenBank/DDBJ databases.
2 PubMed abstract 7969821 |
Domain Name | CRF |
Hormone Name | Corticoliberin |
Mature Hormone Sequence | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII |
Position of mature hormone in Pre-Hormone protein | 41 Residues from position (154-194) |
Receptor | N/A |
Gene ID | 486977 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |