A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10580 |
| Swiss-prot Accession number | P19806 (Sequence in FASTA format) |
| Description | Crustacean hyperglycemic hormones isoform A precursor [Contains: CHHprecursor-related peptide A (CPRP-A); Crustacean hyperglycemic hormoneA (CHH-A) (Molt-inhibiting hormone) (MIH)]. |
| Source organism | Homarus americanus (American lobster) |
| Taxonomical Classification | Eukaryota; Metazoa; Arthropoda; Crustacea; Malacostraca;Eumalacostraca; Eucarida; Decapoda; Pleocyemata; Astacidea;Nephropoidea; Nephropidae; Homarus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released. Present also in the ventral nervous system |
| Post translational modification | Stereoinversion of L-Phe (form CHH-A-I) to D-Phe (form CHH-A- II). |
| Function | CHH is the most abundant hormone in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone. MIH may inhibit Y-organs where molting hormone (ecdysteroid) is secreted and a molting cycle is initiated when MIH secretion diminishes or stops |
| Protein Length | 134 Amino acids |
| Molecular weight | 14996 |
| References | 1 PubMed abstract 7999796 2 PubMed abstract 1879416 3 PubMed abstract 2169734 4 PubMed abstract 2384751 5 PubMed abstract 8034574 |
| Domain Name | Crust_neurohorm |
| Hormone Name | Crustacean hyperglycemic hormone A |
| Mature Hormone Sequence | QVFDQACKGVYDRNLFKKLDRVCEDCYNLYRKPFVATTCRENCYSNWVFRQCLDDLLLSDVIDEYVSNVQMV |
| Position of mature hormone in Pre-Hormone protein | 72 Residues from position (61-132) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |