![]() |
|
|
|
|
|
|
HMRbase accession number | 10415 |
Swiss-prot Accession number | P06884 (Sequence in FASTA format) |
Description | Pancreatic prohormone precursor (Pancreatic polypeptide) (PP)[Contains: Pancreatic hormone; Pancreatic icosapeptide] (Fragment). |
Source organism | Felis silvestris catus (Cat) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;Felinae; Felis. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the NPY family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions |
Protein Length | 66 Amino acids |
Molecular weight | 7483 |
References | 1 PubMed abstract 3827854 |
Domain Name | Hormone_3 |
Hormone Name | Pancreatic hormone |
Mature Hormone Sequence | APLEPVYPGDNATPEQMAQYAAELRRYINMLTRPRY |
Position of mature hormone in Pre-Hormone protein | 36 Residues from position (1-36) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |