A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10377 |
| Swiss-prot Accession number | Q9YGK4 (Sequence in FASTA format) |
| Description | Corticotropin-lipotropin 1 precursor (Corticotropin-lipotropin I)(Pro-opiomelanocortin I) (POMC I) [Contains: Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin]. |
| Source organism | Cyprinus carpio (Common carp) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Cyprinus. |
| Subcellular location | N/A |
| Developmental Stage | N/A |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | N/A |
| Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
| Function | N/A |
| Protein Length | 222 Amino acids |
| Molecular weight | 25417 |
| References | 1 PubMed abstract 9806347 2 PubMed abstract 9806347 |
| Domain Name | NPP ACTH_domain Op_neuropeptide |
| Hormone Name | Beta-endorphin |
| Mature Hormone Sequence | YGGFMKSWDERSQKPLLTLFKNVINKEHQKKDQ |
| Position of mature hormone in Pre-Hormone protein | 33 Residues from position (190-222) |
| Receptor | Q683Z6 Detail in HMRbase Q683Z7 Detail in HMRbase Q6EWJ2 Detail in HMRbase |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments |