A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10299 |
Swiss-prot Accession number | P11962 (Sequence in FASTA format) |
Description | Glycoprotein hormones alpha chain precursor (Anterior pituitaryglycoprotein hormones common subunit alpha) (Follitropin alpha chain)(Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alphachain) (Luteinizing hormone alpha chain) (LSH-alpha) (Thyrotropinalpha chain) (Thyroid-stimulating hormone alpha chain) (TSH-alpha). |
Source organism | Rattus norvegicus (Rat) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 120 Amino acids |
Molecular weight | 13453 |
References | 1 PubMed abstract 6177696 2 PubMed abstract 2467841 3 Kato Y., Ezashi T., Hirai T., Kato T.; "Strain difference in nucleotide sequences of rat glycoprotein hormonesubunit cDNAs and gene fragment."; Zool. Sci. 7:877-885(1990). 4 PubMed abstract 6177696 5 PubMed abstract 2467841 6 Kato Y., Ezashi T., Hirai T., Kato T.; "Strain difference in nucleotide sequences of rat glycoprotein hormonesubunit cDNAs and gene fragment."; Zool. Sci. 7:877-885(1990). |
Domain Name | Hormone_6 |
Hormone Name | Glycoprotein hormones alpha chain |
Mature Hormone Sequence | LPDGDLIIQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKSFTKATVMGNARVENHTDCHCSTCYYHKS |
Position of mature hormone in Pre-Hormone protein | 96 Residues from position (25-120) |
Receptor | P20395
Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |