A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10274 |
Swiss-prot Accession number | Q9PRR0 (Sequence in FASTA format) |
Description | Somatostatin precursor [Contains: Somatostatin-35; Somatostatin-14](Fragment). |
Source organism | Lampetra fluviatilis (River lamprey) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia;Petromyzontiformes; Petromyzontidae; Lampetra. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatostatin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Somatostatin inhibits the release of somatotropin |
Protein Length | 35 Amino acids |
Molecular weight | 3584 |
References | 1 PubMed abstract 8575665 |
Domain Name | Somatostatin |
Hormone Name | Somatostatin-35 |
Mature Hormone Sequence | AAAAPGAAGGAQLPLGNRERKAGCKNFFWKTFSSC |
Position of mature hormone in Pre-Hormone protein | 35 Residues from position (1-35) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |