A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10255 |
Swiss-prot Accession number | Q9PUR0 (Sequence in FASTA format) |
Description | Glucagon-2 precursor [Contains: Glucagon-2 (Glucagon II) (Glu II);Glucagon-like peptide 2-II (GLP-2II)]. |
Source organism | Petromyzon marinus (Sea lamprey) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia;Petromyzontiformes; Petromyzontidae; Petromyzon. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 120 Amino acids |
Molecular weight | 13397 |
References | 1 PubMed abstract 10555286 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-like peptide 2-II |
Mature Hormone Sequence | HSDGSFTNDMNVMLDRMSAKNFLEWLKQQGRG |
Position of mature hormone in Pre-Hormone protein | 32 Residues from position (89-120) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |