A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10253 |
Swiss-prot Accession number | P81027 (Sequence in FASTA format) |
Description | Glucagon-2 (Glucagon II). |
Source organism | Oreochromis niloticus (Nile tilapia) (Tilapia nilotica) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Labroidei;Cichlidae; African cichlids; Pseudocrenilabrinae; Tilapiini;Oreochromis. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level |
Protein Length | 33 Amino acids |
Molecular weight | 3731 |
References | 1 PubMed abstract 7656183 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-2 |
Mature Hormone Sequence | HAGTYTSDVSSYLQDQAAKEFVSWLKTGRGRRD |
Position of mature hormone in Pre-Hormone protein | 33 Residues from position (1-33) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |