A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10252 |
| Swiss-prot Accession number | Q91189 (Sequence in FASTA format) |
| Description | Glucagon-2 precursor (Glucagon II) [Contains: Glicentin-relatedpolypeptide 2 (GRPP 2); Glucagon-2; Glucagon-like peptide 1-2 (GLP 1-2); Glucagon-like peptide 2 (GLP 2)]. |
| Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | N/A |
| Protein Length | 178 Amino acids |
| Molecular weight | 19998 |
| References | 1 PubMed abstract 7776976 |
| Domain Name | Hormone_2 |
| Hormone Name | Glucagon-like peptide 2 |
| Mature Hormone Sequence | HVDGSFTSDVNKVLDSLAAKEYLLWVMTSKTSG |
| Position of mature hormone in Pre-Hormone protein | 33 Residues from position (137-169) |
| Receptor | N/A |
| Gene ID | 100136748 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |