![]() |
|
|
|
|
|
|
HMRbase accession number | 10252 |
Swiss-prot Accession number | Q91189 (Sequence in FASTA format) |
Description | Glucagon-2 precursor (Glucagon II) [Contains: Glicentin-relatedpolypeptide 2 (GRPP 2); Glucagon-2; Glucagon-like peptide 1-2 (GLP 1-2); Glucagon-like peptide 2 (GLP 2)]. |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 178 Amino acids |
Molecular weight | 19998 |
References | 1 PubMed abstract 7776976 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-like peptide 2 |
Mature Hormone Sequence | HVDGSFTSDVNKVLDSLAAKEYLLWVMTSKTSG |
Position of mature hormone in Pre-Hormone protein | 33 Residues from position (137-169) |
Receptor | N/A |
Gene ID | 100136748 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |