A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10250 |
Swiss-prot Accession number | Q9PUR1 (Sequence in FASTA format) |
Description | Glucagon-1 precursor [Contains: Glucagon-1 (Glucagon I); Glucagon-likepeptide 1-I (GLP-1I); Glucagon-like peptide 2-I (GLP-2I)]. |
Source organism | Petromyzon marinus (Sea lamprey) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia;Petromyzontiformes; Petromyzontidae; Petromyzon. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level |
Protein Length | 160 Amino acids |
Molecular weight | 18042 |
References | 1 PubMed abstract 10555286 2 PubMed abstract 8405897 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-like peptide 2-I |
Mature Hormone Sequence | HAEDVNALLDRTMAKTFIEWLEKQNSNDQTD |
Position of mature hormone in Pre-Hormone protein | 31 Residues from position (130-160) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |