A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10245 |
Swiss-prot Accession number | Q9W7M8 (Sequence in FASTA format) |
Description | Thymosin beta. |
Source organism | Danio rerio (Zebrafish) (Brachydanio rerio) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Danio. |
Subcellular location | Cytoplasm (By similarity) |
Developmental Stage | N/A |
Similarity | Belongs to the thymosin beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
Protein Length | 45 Amino acids |
Molecular weight | 5208 |
References | 1 PubMed abstract 10068630 |
Domain Name | Thymosin |
Hormone Name | Thymosin beta |
Mature Hormone Sequence | ADKPNMTEITSFDKTKLRKTETQEKNPLPTKETIEQERQGESTP |
Position of mature hormone in Pre-Hormone protein | 44 Residues from position (2-45) |
Receptor | N/A |
Gene ID | 402820 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |