A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10235 |
Swiss-prot Accession number | Q6S9C5 (Sequence in FASTA format) |
Description | Thymosin beta-4 (T beta-4) [Contains: Hematopoietic system regulatorypeptide (Seraspenide)]. |
Source organism | Chinchilla lanigera (Long-tailed chinchilla) (Chinchilla villidera) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Chinchillidae; Chinchilla. |
Subcellular location | Cytoplasm (By similarity) |
Developmental Stage | N/A |
Similarity | Belongs to the thymosin beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization. |
Protein Length | 44 Amino acids |
Molecular weight | 5053 |
References | 1 Erdos G., Hu F.Z., Donfack J., Ahmed A.I., Preston R.A., Hayes J.D.,Post J.C., Ehrlich G.D.; "The thymosin beta-4 gene is expressed in chinchilla middle earmucosa."; Submitted (NOV-2003) to the EMBL/GenBank/DDBJ databases.
|
Domain Name | Thymosin |
Hormone Name | Thymosin beta-4 |
Mature Hormone Sequence | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
Position of mature hormone in Pre-Hormone protein | 43 Residues from position (2-44) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |