A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10234 |
Swiss-prot Accession number | Q9I980 (Sequence in FASTA format) |
Description | Thymosin beta-10 (Thymb10). |
Source organism | Torpedo marmorata (Marbled electric ray) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Elasmobranchii; Squalea; Hypnosqualea; Pristiorajea; Batoidea;Torpediniformes; Torpedinoidei; Torpedinidae; Torpedo. |
Subcellular location | Cytoplasm (By similarity) |
Developmental Stage | N/A |
Similarity | Belongs to the thymosin beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
Protein Length | 44 Amino acids |
Molecular weight | 4916 |
References | 1 O'Regan S., Matz V., Cha N., Meunier F.M.; "Torpedo electric lobe cDNAs that suppress a choline metabolismmutation in yeast."; Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases.
|
Domain Name | Thymosin |
Hormone Name | Thymosin beta-10 |
Mature Hormone Sequence | ADKPDFGEVASFDKSKLKKTDTEVKNTLPTKETIDQEKKAESS |
Position of mature hormone in Pre-Hormone protein | 43 Residues from position (2-44) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |