A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10227 |
Swiss-prot Accession number | P87495 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Carassius auratus (Goldfish) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | Pituitary gland |
Post translational modification | N/A |
Function | N/A |
Protein Length | 210 Amino acids |
Molecular weight | 23288 |
References | 1 PubMed abstract 8652671 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | VGLNDLLERASQLSDKLHSLSTSLTNDLDSHFPPVGRVMMPRPSMCHTSSLQIPNDKDQALKVPEDELLSLARSLLLAWSDPLALLSSEASSLAHPERNTIDSKTKELQDNINSLGAGLEHVFNKMDSTSDNLSSLPFDINSLGQDKTSRLVNFHFLLSCFRRDSHKIDSFLKVLRCRAAKKRPEMC |
Position of mature hormone in Pre-Hormone protein | 187 Residues from position (24-210) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |