A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10226 |
Swiss-prot Accession number | Q28318 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Capra hircus (Goat) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Capra. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Prolactin acts primarily on the mammary gland by promoting lactation |
Protein Length | 229 Amino acids |
Molecular weight | 25774 |
References | 1 PubMed abstract 7969789 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | TPVCPNGPGNCQVSLRDLFDRAVMVSHYIHNLSSEMFNEFDKRYAQGKGYITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGVPDAILSRAIEIEEENKRLLEGMEMILGQVIPGAKETEPYPVWSGLPSLQTKDEEARHSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC |
Position of mature hormone in Pre-Hormone protein | 199 Residues from position (31-229) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |